General Information

  • ID:  hor005405
  • Uniprot ID:  P09477
  • Protein name:  Insulin B chain
  • Gene name:  ins
  • Organism:  Platichthys flesus (European flounder) (Pleuronectes flesus)
  • Family:  insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Platichthys (genus), Pleuronectidae (family), Pleuronectoidei (suborder), Pleuronectiformes (order), Carangaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VVPPQHLCGAHLVDALYLVCGERGFFYTPK
  • Length:  30
  • Propeptide:  VVPPQHLCGAHLVDALYLVCGERGFFYTPKGIVEQCCHKPCNIFDLQNYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09477-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005405_AF2.pdbhor005405_ESM.pdb

Physical Information

Mass: 384838 Formula: C155H233N39O39S2
Absent amino acids: IMNSW Common amino acids: LV
pI: 7.42 Basic residues: 4
Polar residues: 8 Hydrophobic residues: 12
Hydrophobicity: 38.67 Boman Index: -291
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 97.33
Instability Index: 2095 Extinction Coefficient cystines: 3105
Absorbance 280nm: 107.07

Literature

  • PubMed ID:  3556313
  • Title:  Primary structure of insulin and glucagon from the flounder (Platichthys flesus).